PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa007525
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family ARR-B
Protein Properties Length: 489aa    MW: 55481.7 Da    PI: 6.5109
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58691804PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-16844PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.11.7e-27283336155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                k +++W++eLH++Fv+aveqL G ++A+P++ilelm+v+gLt+++v+SHLQkYRl
  Lsa007525 283 KVKVDWSSELHKKFVQAVEQL-GVDQAIPSRILELMNVEGLTRHNVASHLQKYRL 336
                5689*****************.********************************8 PP

2Response_reg32.73.9e-12201261109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+ d++ + ++++++ le+ +y +v ++ +  +al  + +k   +++ ++ ++  + dG   +k +++++ +lp i+ ++ +  +++ +++ +Ga 
     Lsa007525  20 VLLLDEDIDSANVIKSKLEEMDY-VVSAFYSENDALSAISDKSkgFHVAIVEVRAGNEDGR--FKFLERAK-DLPTIMTSDVNCISTMMKCIALGAV 112
                   7999999****************.***************777778***************5..66676655.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   +fl+Kp ++++l++
     Lsa007525 113 EFLEKPLSEDKLRN 126
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.39E-1516134IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23008.6E-1716150No hitNo description
SMARTSM004486.8E-418128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011020.98519132IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-820127IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.73E-1021132No hitNo description
PROSITE profilePS5129413.913280339IPR017930Myb domain
SuperFamilySSF466896.72E-18282339IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-26282339IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-25283337IPR006447Myb domain, plants
PfamPF002495.6E-8286335IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MVCTANDLLG WKDFPKGLRV LLLDEDIDSA NVIKSKLEEM DYVVSAFYSE NDALSAISDK  60
SKGFHVAIVE VRAGNEDGRF KFLERAKDLP TIMTSDVNCI STMMKCIALG AVEFLEKPLS  120
EDKLRNIWQH VAHKAFNAGA KDENELLKSE EALIRLEKVG IKQEIIQNKE HNEEVSVESD  180
KYHAPSTPQL KQGMRHVDNE DQTNLSTEKE CVEHDGESKF VEITCDDHLV VDNVMETNFS  240
KSLEEGINKP SSNECCPDPK DGKKQNEASE HPISRSSKSG RRKVKVDWSS ELHKKFVQAV  300
EQLGVDQAIP SRILELMNVE GLTRHNVASH LQKYRLQRRH ILPKESGRKW PQTRHHSTPR  360
NYYPQKPIMA YPPPYHSNQV YPTWPPPHSY PPPPQTWGPP YYPTWHSSVS WLWNPYQETQ  420
AETWGCPTIP SHPSFPQGDE VIDKVVKEAI NKPWLPLPLG LKPPSTESVI SELSKQGIST  480
VPPKINGCH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-16279341163ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279150.10.0PREDICTED: two-component response regulator-like APRR2
SwissprotQ6LA431e-115APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLF6HTC70.0F6HTC7_VITVI; Putative uncharacterized protein
STRINGVIT_02s0012g00570.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-105ARR-B family protein